SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5W5W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5W5W6
Domain Number 1 Region: 9-37
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000000157
Family Capz alpha-1 subunit 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5W5W6
Sequence length 91
Comment (tr|A0A2K5W5W6|A0A2K5W5W6_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000032470} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MANFVDCVLDEEKVRIAAEFITHAPPGEFNEVFSDLNGRHVHPSPPDCFDHHLLHLRTVI
FKSLDWDFSGSFWRAKEVSASLGNLFLNPKT
Download sequence
Identical sequences A0A2K5W5W6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]