SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5Y6I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5Y6I4
Domain Number 1 Region: 9-243
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-76
Family Capz alpha-1 subunit 0.0000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5Y6I4
Sequence length 248
Comment (tr|A0A2K5Y6I4|A0A2K5Y6I4_MANLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLEP00000011177} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MADFDDCVSDEKVGIAAKFITHAPPEEFSEVFNDIQLLLNNDSLLRGGVAHYNMDQFKPV
KIEGYEDQVLITEHSNLGNKELDGRLKSWRESCDSVLRAYVKDHYSNGFCIVYAKTINGQ
QTITFQPKNFRNGRWRSEWKFTITPPTTQVVGVLKIQVHYYEVGSVQLVSHKDVQDSLTV
SNEAQTAKEFIKIIENAENEYQTAIGENYQTVSDTTLKALCLQLPITCTKIDWNKIVSYK
IGQEMQNA
Download sequence
Identical sequences A0A2K5Y6I4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]