SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K5Z5F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5Z5F6
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-117
Family Capz alpha-1 subunit 0.000000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5Z5F6
Sequence length 286
Comment (tr|A0A2K5Z5F6|A0A2K5Z5F6_MANLE) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSMLEP00000023059} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=CAPZA1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A096NE85 A0A2J8UM21 A0A2K5IZI6 A0A2K5UBE7 A0A2K5Z5F6 A0A2K6BXE9 A0A2K6JWD5 A0A2K6U4H5 F6QI70 H9G0D0
NP_001248143.1.72884 XP_002751276.1.60252 XP_003933520.1.74449 XP_005542393.1.63531 XP_007975747.1.81039 XP_011735361.1.29376 XP_011788556.1.43180 XP_011856146.1.47321 XP_012322009.1.9421 XP_017725209.1.44346 ENSPANP00000011194 ENSCJAP00000024981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]