SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5Z5Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5Z5Q2
Domain Number 1 Region: 12-276
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-114
Family Capz alpha-1 subunit 0.00000000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5Z5Q2
Sequence length 281
Comment (tr|A0A2K5Z5Q2|A0A2K5Z5Q2_MANLE) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSMLEP00000023070} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=CAPZA1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
RLRQEDRLSPGAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPV
KIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGGLKSWRESCD
SALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPT
AQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISE
NYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A2K5UBH4 A0A2K5Z5Q2 A0A2K6BXF7 A0A2K6JWF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]