SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6AH45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6AH45
Domain Number 1 Region: 2-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-98
Family Capz beta-1 subunit 0.000000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6AH45
Sequence length 276
Comment (tr|A0A2K6AH45|A0A2K6AH45_MANLE) Capping actin protein of muscle Z-line beta subunit {ECO:0000313|Ensembl:ENSMLEP00000039389} KW=Complete proteome OX=9568 OS=Mandrillus leucophaeus (Drill) (Papio leucophaeus). GN=CAPZB OC=Catarrhini; Cercopithecidae; Cercopithecinae; Mandrillus.
Sequence
IDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLL
CDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYL
WDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNK
SGSGTMNLGGSLTRQMEKDETVGDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVN
GLRSIDAIPDNQKFKQLQRELSQVLTQRQIYIQPDN
Download sequence
Identical sequences A0A1D5Q2R0 A0A2I3NCM6 A0A2K5HIV8 A0A2K5LV60 A0A2K5TMH8 A0A2K6AH45 A0A2K6DF22 A0A2K6MKS1 A0A2K6Q1R5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]