SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6CB30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6CB30
Domain Number 1 Region: 5-89
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.1e-21
Family Co-chaperone p23-like 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K6CB30
Sequence length 138
Comment (tr|A0A2K6CB30|A0A2K6CB30_MACNE) Uncharacterized protein {ECO:0000313|Ensembl:ENSMNEP00000020856} KW=Complete proteome OX=9545 OS=Macaca nemestrina (Pig-tailed macaque). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
IEFCDVNVNFEKSNLTFSCLGESDNFKHLNEIDLFYCIDPNDSKHKRMDRSILYCLQTGE
SGQSWPKLTKERAKLNCLSVDLNNWKDWEDGSDEDRSNFDTNDDSQDSDDEKCQIWSKKY
CHHLDFEKENNFSPRFHN
Download sequence
Identical sequences A0A2K6CB30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]