SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6EV55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6EV55
Domain Number 1 Region: 27-119
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.93e-17
Family Co-chaperone p23-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6EV55
Sequence length 142
Comment (tr|A0A2K6EV55|A0A2K6EV55_PROCO) Prostaglandin E synthase 3 like {ECO:0000313|Ensembl:ENSPCOP00000005610} KW=Complete proteome OX=379532 OS=coquereli). GN=PTGES3L OC=Lemuriformes; Indriidae; Propithecus.
Sequence
TFSFPLNPSPNHIRQGSCWGPAGAAMARCKNAEGVELYNEIEFYAKVNSKDSQDKRSCRS
ITCFVRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEVELAHVEHYAELLKKVST
KRPPPAMDDLDDDSDSADATSN
Download sequence
Identical sequences A0A2K6EV55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]