SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6FH44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6FH44
Domain Number 1 Region: 688-834
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.06e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1014-1110
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.06e-29
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 224-357
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-21
Family Phosphotyrosine-binding domain (PTB) 0.025
Further Details:      
 
Domain Number 4 Region: 9-97
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-20
Family PDZ domain 0.0088
Further Details:      
 
Domain Number 5 Region: 959-1028
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000132
Family Ras-binding domain, RBD 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6FH44
Sequence length 1436
Comment (tr|A0A2K6FH44|A0A2K6FH44_PROCO) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSPCOP00000013296} KW=Complete proteome OX=379532 OS=coquereli). GN=RGS12 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MYRAGDPGRRPLPPRVRNVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQI
FAVNEINVKKASHEDVVKLIGKCSGVLRMVVGEGVGHLESCSSDEEGGLYEGKGWLKPKL
DSKALGINRAERVVEEMQSGGIFNMIFENPSLCAGSSEPLKLKQRSLSESAAAQFDIGHE
SINNPNPHMFSKEEVLKVINDDSVFSIGLENHDDFGLDASILNVAMVVGYLGSIELPSRS
SSLESDSLQAIRGCMRRLRAEQKIHSLVMMKIVHDCVQLCTDKARVVAEYPAEKLAFSAV
CPDDRRFFGLVTMQTSDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFGFECT
ADPDTNGCLEFPVSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDS
GIGNFNQEEKSNRVLVVDLGGGSSRHGLGGSTGWEGAGGRATQPWGAPWNGAFCHDPDGS
SPLEVTPQTDRFRDLNKHLGPTSHVEVPLASSRSSVPPPKRGTVGASCGFSQRWLPVHVL
QEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEASFAQPPLGTQKRDWS
RKAFGMQNIFGPHRNVRKTKENKKGSKFGRGIGLTQTSQRTSARRSFGRSKRFSITRSLD
DLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDP
LGVHYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVN
IDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRALPD
SQQAPSSPVSKHSLGSDHSSMSTPKKLSGKSKSGRSLNEELAEEDSEKKRKGAFFSWSRS
RSTGRSQKKKEHGDLPNDPILANGGPCRRESQGSMSSAGSLDLSEACRTLVPEKDKAAKH
CCILLPDGTSCVVAVKSGFSIKEILSGLCERHGINGAAVDLFLVGGDKPLVLHQDSSILE
SRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGEKE
ALDLGAPISSLDGQRVILEEKDPSRGKDKQKGALAKQNTAVNPSSRNHSATGEERTLGKS
NSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQR
GLLRKEDLVLPEFLRLPPGSTELTLSTPATAQAISRRTATTSGRENASPPQERWAPGQDS
SDSPSTSLGSAHSPPGPSGTTPPEQKSPSGPFCIPQSPTPHTQEGTAQMWKRQSWEAQSG
DIQTVEDGQGADLTLVGEAHISSPNSTLLPPPPAPQDTPGPPRPGTSGSRGLPVNTIIDV
DLVGSAPRLGGSVLGVRAGPRRLRASGSPTPDFPGLSPSPGEPAKPKASAYHATFV
Download sequence
Identical sequences A0A2K6FH44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]