SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6GWZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6GWZ5
Domain Number 1 Region: 9-161
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 9.42e-51
Family Troponin I 0.00000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6GWZ5
Sequence length 187
Comment (tr|A0A2K6GWZ5|A0A2K6GWZ5_PROCO) Troponin I1, slow skeletal type {ECO:0000313|Ensembl:ENSPCOP00000030796} KW=Complete proteome OX=379532 OS=coquereli). GN=TNNI1 OC=Lemuriformes; Indriidae; Propithecus.
Sequence
MPEVERKPKITASRKLLLKSLMLAKAKECWEQENEEREAEKSRYLAERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSA
DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA
AKSPTSQ
Download sequence
Identical sequences A0A2K6GWZ5
XP_012520413.1.63892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]