SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6H0Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6H0Y1
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 4.82e-71
Family Bcl-2 inhibitors of programmed cell death 0.000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6H0Y1
Sequence length 191
Comment (tr|A0A2K6H0Y1|A0A2K6H0Y1_PROCO) BH3 interacting domain death agonist {ECO:0000313|Ensembl:ENSPCOP00000032105} KW=Complete proteome OX=379532 OS=coquereli). GN=BID OC=Lemuriformes; Indriidae; Propithecus.
Sequence
VSNGSGLKDARITDLLVFGFLQSCSSNSFQAELEALGYELPVQDHLWEDHEDELQTDGSR
ASRFHAQRIEADSESEEDLIQNLARQLAQIGDSMDRSIPPRLVNHLAMQFMNPNLLEEDR
RRHLATALEQLMQTCPADLEQEKATLVLTMLLAKKVADHTPSLLRDVFRTTVNFINQNLL
TYVRNLARNMD
Download sequence
Identical sequences A0A2K6H0Y1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]