SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6LCJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6LCJ0
Domain Number 1 Region: 9-252
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-85
Family Capz alpha-1 subunit 0.00000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6LCJ0
Sequence length 257
Comment (tr|A0A2K6LCJ0|A0A2K6LCJ0_RHIBE) Uncharacterized protein {ECO:0000313|Ensembl:ENSRBIP00000021226} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN= OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MANFADCVLDEEKVRIAAKFITHAPPGEFNEVFSDVRLLRNNDNLLRERAEHAFAHYNVN
QFAPVKTERYEDQVLITEHGDLGNSRKEASDPQPEQVDGGLNALRAYEKDHYSNGFCTVY
AKTTYGQQTIIACIESHQSQPKNLWNGRWRSEWKFTITLPTVLKIQVHYYEDGNVRLVSH
KDVHDSLTVSNDTQTAKEFIKIIENAENERQTAISDNYQTMSDTTFKVLRQQLPVTRTKI
DWNKILSYNIGKEMQNA
Download sequence
Identical sequences A0A2K6LCJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]