SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6MEU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6MEU0
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 9.61e-16
Family LEM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6MEU0
Sequence length 108
Comment (tr|A0A2K6MEU0|A0A2K6MEU0_RHIBE) LEM domain containing 1 {ECO:0000313|Ensembl:ENSRBIP00000034303} KW=Complete proteome OX=61621 OS=Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti). GN=LEMD1 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDG
AQDSDDSEGGLQKHQAPESHMGLSPKREATARKTRLLRAGKKKVSQWA
Download sequence
Identical sequences A0A2I3NA98 A0A2K5ZWX3 A0A2K6MEU0 A0A2K6QSN6
XP_010360767.1.97406 XP_011845798.1.47321 XP_011845799.1.47321 XP_017736463.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]