SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6NAY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6NAY8
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-114
Family Capz alpha-1 subunit 0.000000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6NAY8
Sequence length 286
Comment (tr|A0A2K6NAY8|A0A2K6NAY8_RHIRO) Capping actin protein of muscle Z-line alpha subunit 2 {ECO:0000313|Ensembl:ENSRROP00000001450} KW=Complete proteome OX=61622 OS=roxellana). GN=CAPZA2 OC=Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A0D9RET3 A0A2J8UPF7 A0A2K5WVG2 A0A2K6E5B7 A0A2K6MZI2 A0A2K6NAY8 A0M8R8 A4D0V4 F7H1J4 K7DGP2 P47755 Q07DY0 Q07DZ0 Q2IBA7 Q2IBE7 Q2QLF0 Q5R4P6
gi|5453599|ref|NP_006127.1| ENSPTRP00000047674 ENSMMUP00000008923 ENSPPYP00000020107 ENSGGOP00000011862 ENSMMUP00000008923 ENSP00000393509 NP_001129289.1.37143 NP_001162080.1.72884 NP_006127.1.87134 NP_006127.1.92137 XP_004046144.1.27298 XP_007980871.1.81039 XP_010362664.1.97406 XP_010387645.1.97406 XP_011729342.1.29376 XP_017722830.1.44346 ENSP00000354947 ENSPTRP00000047674 ENSPANP00000006369 ENSPPYP00000020107 ENSP00000354947 ENSGGOP00000011862 9544.ENSMMUP00000008923 9600.ENSPPYP00000020107 9606.ENSP00000354947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]