SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2K6SAB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6SAB8
Domain Number 1 Region: 31-297
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-98
Family Capz beta-1 subunit 0.000000000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K6SAB8
Sequence length 301
Comment (tr|A0A2K6SAB8|A0A2K6SAB8_SAIBB) Capping actin protein of muscle Z-line beta subunit {ECO:0000313|Ensembl:ENSSBOP00000004314} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=CAPZB OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
MHPSRRSLPFPLNCQLVRVGTADYGSPSDQSDQQLDCALDLMRRLPPQQIEKNLSDLIDL
VPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSA
RLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIA
NIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQ
C
Download sequence
Identical sequences A0A2I3S4X4 A0A2K6SAB8
XP_009447975.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]