SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K6U471 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K6U471
Domain Number 1 Region: 13-161
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 2.62e-51
Family Troponin I 0.00000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K6U471
Sequence length 182
Comment (tr|A0A2K6U471|A0A2K6U471_SAIBB) Troponin I2, fast skeletal type {ECO:0000313|Ensembl:ENSSBOP00000026700} KW=Complete proteome OX=39432 OS=Saimiri boliviensis boliviensis (Bolivian squirrel monkey). GN=TNNI2 OC=Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Sequence
VSQSEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEVRVQKSSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFES
ES
Download sequence
Identical sequences A0A2K6U471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]