SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K7ZMT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K7ZMT9
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.58e-39
Family Frataxin-like 0.00000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K7ZMT9
Sequence length 106
Comment (tr|A0A2K7ZMT9|A0A2K7ZMT9_YEREN) Iron donor protein CyaY {ECO:0000313|EMBL:AHM76304.1} KW=Complete proteome OX=1443113 OS=Yersinia enterocolitica LC20. GN=LC20_05053 OC=Yersiniaceae; Yersinia.
Sequence
MNDSEFHQLADQLMLYIEETLDGFSGDSDIDYETNGGVMTLTFDNGSKIVINRQEPLHQV
WLATKAGGYHFDYRAGHWYCSRSGEEFLTKLSEAATAQAGEDVRFI
Download sequence
Identical sequences A0A209APG0 A0A2K7ZMT9
WP_025379914.1.19252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]