SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0EDL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0EDL6
Domain Number 1 Region: 4-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-66
Family Capz beta-1 subunit 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0EDL6
Sequence length 275
Comment (tr|A0EDL6|A0EDL6_PARTE) Uncharacterized protein {ECO:0000313|EMBL:CAK93383.1} KW=Complete proteome; Reference proteome OX=5888 OS=Paramecium tetraurelia. GN=GSPATT00025727001 OC=Oligohymenophorea; Peniculida; Parameciidae; Paramecium.
Sequence
MESKEKILSCLNILKRLPPTQIQKNAAALASLIPDYAEELYQKIDKPLDIGQDEKGNQYI
QSEFNRDGDSFRSHVTNQYYPQIDDAVYPSDALRKLEIKANAVFDEYRRLYYEGGLSSCY
FWDKEDGGFATAWLIRKNVEKSKGIEDGSWSSINVIDIKTDGKSKWTYKITTSVVLEMNI
VQNQDVGKFNITGTLTKQKEESFEAPAGNKDLELFHIMKIGTLVEDVESYLRSQLDGVYF
GKTKDIVFQTRFIEGEKHFIQQRQGLAGEFKQKYG
Download sequence
Identical sequences A0EDL6
GSPATP00025727001 XP_001460780.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]