SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0PFK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0PFK4
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-98
Family Capz beta-1 subunit 0.000000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0PFK4
Sequence length 272
Comment (tr|A0PFK4|A0PFK4_PIG) F-actin capping protein subunit beta 2 {ECO:0000313|EMBL:CAL69434.1} OX=9823 OS=Sus scrofa (Pig). GN=CP OC=Sus.
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTFADKSKQEALKNDLVEALKRKQQS
Download sequence
Identical sequences A0A1V4KR17 A0PFK4 B5G462
NP_001167000.1.86415 NP_001232202.1.42559 XP_005145484.1.78019 XP_005229685.1.75256 XP_005528315.1.90289 XP_009888274.1.48241 XP_010575564.1.12557 XP_011583440.1.59079 XP_014128780.1.73095 XP_014457464.1.47583 XP_014737173.1.99236 XP_015737802.1.68032 XP_017688888.1.3805 XP_017941795.1.51550 XP_019367457.1.87953 XP_019397042.1.79039 XP_021272946.1.32913 XP_021389455.1.53032 ENSGALP00000006414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]