SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0PXF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0PXF2
Domain Number 1 Region: 22-97
Classification Level Classification E-value
Superfamily TPR-like 0.0000000527
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  A0PXF2
Domain Number - Region: 75-168
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz beta-1 subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0PXF2
Sequence length 320
Comment (tr|A0PXF2|A0PXF2_CLONN) Uncharacterized protein {ECO:0000313|EMBL:ABK62177.1} KW=Complete proteome; Reference proteome OX=386415 OS=Clostridium novyi (strain NT). GN=NT01CX_0957 OC=Clostridium.
Sequence
MIILSFSGCANESKGNVVTSDVKKEAKLKDDKIKSYIEEGSKLLGEKKFDEAKSAFQKAI
SEDKSNKDTYIKIKDKYMENQRMDDAYQIINLAVKNNVDTENMKKLSSDIKSKFEVPIIE
QKAYEYGKYSLPSSVKIKINNEEKQVNVVWNNPKVDTTKVKVKKYTGKAQGYDREVQLNL
SILPVKTVKKTVYAMGTYIKNNRRYLKTREVEFFRDTDEDMDIAERMAIQDGHADYLIDG
RVDDDYYIRDLNKPMKVYEMAPNASISVCEYMVNSSGSAGQNKINYERFSKLNNGQYNQI
LSYIFLKNGIIVKYEQQYLP
Download sequence
Identical sequences A0PXF2
gi|118444677|ref|YP_877054.1| 386415.NT01CX_0957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]