SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1BYM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1BYM8
Domain Number - Region: 70-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00536
Family F93-like 0.083
Further Details:      
 
Domain Number - Region: 19-69
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz alpha-1 subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1BYM8
Sequence length 116
Comment (tr|A1BYM8|A1BYM8_BACCE) Conserved hypothetical plasmid protein {ECO:0000313|EMBL:ABK00529.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=B4079_0267 OC=Bacillus cereus group.
Sequence
MSNISMSSSEIIDVLCENLNDGIWALRVLYAEGAMNKEKLWDYINQYHKDYQIENEKDYE
GKKILPSRYALDIMTARLEGAGLISFKAIGRVRIYDVTDLGNVLIKELEKRVEKNN
Download sequence
Identical sequences A0A0F5RGX2 A0A0U0GJM5 A1BYM8 B7I167 B7JTH0 J4A282 J8CT45 R8DM41
gi|190015505|ref|YP_001967230.1|NC_010924 gi|208702247|ref|YP_002267419.1|NC_011339 gi|217956739|ref|YP_002335833.1|NC_011655 gi|218848483|ref|YP_002454954.1|NC_011777 gi|402558130|ref|YP_006599400.1|NC_018492 gi|402558781|ref|YP_006593913.1|NC_018486 405534.BCAH187_C0097 405535.BCAH820_B0068 gi|402558130|ref|YP_006599400.1| gi|217956739|ref|YP_002335833.1| gi|218848483|ref|YP_002454954.1| gi|402558781|ref|YP_006593913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]