SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1CMH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1CMH9
Domain Number - Region: 31-74
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0248
Family Integrin beta tail domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1CMH9
Sequence length 177
Comment (tr|A1CMH9|A1CMH9_ASPCL) Uncharacterized protein {ECO:0000313|EMBL:EAW08766.1} KW=Complete proteome; Reference proteome OX=344612 OS=NCTC 3887 / NRRL 1). GN=ACLA_097010 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTINILLFQPVSYGKTIPLCILSLRQAECLGSCVLCSLWETKPQEANAMAYNGNFVNPMT
TTELDEDSCVLYQTGYRPNQEGQRTWWVWIPLVGTFGSDFQLLGAMIESIARGHASLAPN
WDRTSAGGVWYDFDCASDILDEKTLFGLATDDLQNRLENEMASSVGHAGQKPAMGFR
Download sequence
Identical sequences A1CMH9
XP_001270192.1.35617 5057.CADACLAP00008959 ACLA_097010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]