SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1CT81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1CT81
Domain Number 1 Region: 2-256
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-83
Family Capz alpha-1 subunit 0.00000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1CT81
Sequence length 264
Comment (tr|A1CT81|A1CT81_ASPCL) F-actin capping protein alpha subunit, putative {ECO:0000313|EMBL:EAW06518.1} KW=Complete proteome; Reference proteome OX=344612 OS=NCTC 3887 / NRRL 1). GN=ACLA_082080 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSSTIEIASSFIEGAPPGEALTSDEPDITPSLAPAFQRYNENQLTTVKLPGASQEVILSE
YNRLEGNRYFDVESQTSFEVDHVTQEASAAQSHVLESQNADLIKSLLKSLAKHAAEHYPN
CSYGVYPTEDDTAVAILLVANRYSPNNFWNGRFRSIYTVPVSESTTVTGKILVDVHYYED
GNVALNTNKPVNVSVPSLSAESIISRIAAAERDYQEELNRAFVQMADGAFKHLRRQLPIT
RQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences A1CT81
5057.CADACLAP00007655 XP_001267944.1.35617 ACLA_082080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]