SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1E328 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1E328
Domain Number 1 Region: 50-105
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 5.89e-33
Family Arterivirus nucleocapsid protein 0.0000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1E328
Sequence length 110
Comment (tr|A1E328|A1E328_EAV) Nucleocapsid protein {ECO:0000313|EMBL:ABL14340.1} OX=11047 OS=Equine arteritis virus (EAV). GN= OC=Nidovirales; Arteriviridae. OH=9788
Sequence
MASRRSRPQAASFRNGRRRQPTSYNDLLRMFGQMRVRKPPAQPTQAIIAEPGDLRNELNQ
QERATLSSNVQRFFMIGHGSLTADAGGLTYTVSWVPTKQIQRKVAPSAGP
Download sequence
Identical sequences A1E328
A1E328_EAV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]