SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1WZQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1WZQ6
Domain Number - Region: 29-78
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.034
Family Troponin I 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1WZQ6
Sequence length 91
Comment (tr|A1WZQ6|A1WZQ6_HALHL) Uncharacterized protein {ECO:0000313|EMBL:ABM63168.1} KW=Complete proteome; Reference proteome OX=349124 OS=halophila (strain DSM 244 / SL1)). GN=Hhal_2405 OC=Ectothiorhodospiraceae; Halorhodospira.
Sequence
MIDQKTIDELAQKLTASLPAGVREFHDEVEKNVRASLQSGFSRLDLVTREEFDAQAKVLA
RTRAQLEELNRRVAELEKDQGGSGGAGGSGS
Download sequence
Identical sequences A1WZQ6
WP_011815190.1.47253 gi|121999183|ref|YP_001003970.1| 349124.Hhal_2405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]