SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1ZBI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A1ZBI1
Domain Number - Region: 9-79
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0228
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1ZBI1
Sequence length 173
Comment (tr|A1ZBI1|A1ZBI1_DROME) Uncharacterized protein {ECO:0000313|EMBL:AAS64806.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG33454 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLANVIILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHIN
ATFLHPINSISVRFQMLKRANGYKPFLFDITVDACQFLRKPNNPVIKIVYNMIKDASNIN
HSCPYGTVVLNDFHRISLPLPFPSGDYLSRLDFLINGKTKFYVNVNMHVPEDL
Download sequence
Identical sequences A1ZBI1
FBpp0085749 7227.FBpp0085749 FBpp0085749 NP_995887.1.81976 FBpp0085749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]