SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2DBM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2DBM8
Domain Number 1 Region: 4-250
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-65
Family Capz beta-1 subunit 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2DBM8
Sequence length 278
Comment (tr|A2DBM8|A2DBM8_TRIVA) F-actin capping protein, beta subunit, putative {ECO:0000313|EMBL:EAY22231.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_094060 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSYDSPVTAGLDLLRHVPPKDVEERMFDIFQLNPELTDEMISAVDIPLKIQQDKDTHQDF
IKCDYNRDGDSYRSPFTNKYYPPISDGQTPSPKLRKLEELANKAFSSYLNLFFRYGTLSV
YTWDLDGTAFGLGVFVRKDADPKQEGFEGNISCSDVFTITESSSGQYDYEMVSSILLEIK
VQGDKGVPVILSGGCADSKVKSLPAKNDIEMLVNVGTMIEDNAANFMEHVKQIYVSKMTE
ILSYTKGIAIGGPGNTPQDQLAAALKAHMASNSVDLLV
Download sequence
Identical sequences A2DBM8
gi|121917457|gb|EAY22231.1| gi|154420404|ref|XP_001583217.1| 83472.m00541 5722.A2DBM8 XP_001583217.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]