SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2EA85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2EA85
Domain Number 1 Region: 1803-2083
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-80
Family BEACH domain 0.00000248
Further Details:      
 
Weak hits

Sequence:  A2EA85
Domain Number - Region: 1687-1723,1758-1797
Classification Level Classification E-value
Superfamily PH domain-like 0.00922
Family PreBEACH PH-like domain 0.039
Further Details:      
 
Domain Number - Region: 2038-2093,2138-2343
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0275
Family WD40-repeat 0.04
Further Details:      
 
Domain Number - Region: 257-324
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0602
Family Capz beta-1 subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2EA85
Sequence length 2348
Comment (tr|A2EA85|A2EA85_TRIVA) Beige/BEACH domain containing protein {ECO:0000313|EMBL:EAY10425.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_271160 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSFAYHPAQEPCIGSALPSNSFVNRLKKITERLNMDQPIYPDIDTIYSFCLEYVNAITVY
MLQGFPKDYEPLPDFVAFIDILIYYLDQYDTKPEIDKDVFLQCLYITTKGLNADIVFKDE
PSLLNVLKLIADSNSKAVQDDFKNTLFRAILKSPQNKKVILTNTFFLLTCKRFFNHVEYS
KFIDDNLKQIISLFVLDSIDLDTSYVCTFFFNMISNNSIPNENAYSAIKFLTSYLKMNTL
HAKKAINEIFPSLNGFSLILNLLIQANPQKIKLVFYDLCTLTKKAEESTLNFIMAEIGNS
NQKLNVIVQLYSTISMVITQKGFSSHDIEFITDPSVFMRPHQSMDEEMKTCTCFLFNRFC
ALGYKYVKLCLSPLLDNFLDGISDQHCEWISEGLDLAGRGLISPTDLKNGNLLELFIVLQ
SPDFIAHILEIFTKLTPCLASAYGAENDPNKKFIIITQILHSQQYFKDQNKFLNSFSMFI
IEDKEKHIVLTRLMEMCFKSMTDEIMLAISYVFMQDENTCLVFLNKCNGLQVLDDIINSV
EITEENKSLFLESLTTGDTAMIISDWILSLNPNHNLFKIEPRNLWNIIFFDDGKTLCIRV
PSLIPFVPLPPDVVLSPADIYLIYTKALKDFTTREYTIEMSQIISAITNRYISFSDYKKL
IYSKKKISPMCNENLDHFPVFELQPFKKESYIHIMRFAKAISFWVKLENYTDQTITILTA
NNLEITLLNDNFTVKYHGTIYGIVKVESTHWVLMHINLVNELLRCVLNVGIGNKTVEIVL
PDPIEHFSSFTIGKVDETTKTRFFIGPAIRLFSKQVQDKKKIESLGVSSMKMTTEILLIT
PNWGDDEMFGKGCFKVPYKSFCSFLQEKERLIELYNIILDMDDPILISDYIKCLISCHQI
NNCGGETFWPMIKLLFKRKHEYLKDTSTLDLITTLYYNSCIHYIGNDIEMWELYPDKMCQ
ISPYNDTLRAYMATLCFSRMLQKQEYSSLLLALNDVGNYNAVYNLFCISDETIQLSILNH
IIMKNKMNFDNKLLSVFQFNRLIMIMLTSTMTVSRRILDLICLINSNEKDYVKPTISFSC
AVMRLIESESLKNTLLSLLTGTFEVEVLINAIQVNRPHIIPALLFILILTISADFAMCGD
ENKIDQAVNFFENQLSMLIDLFTSICVGYRTNLLGTPEILDLISFVFPWMFDLKTLKENE
ETKVDGIIDQSKLKHMLFDSWNLPSYLESEVKDPVEIKSNFETQNHLILNSVLSLIRKCC
PEYDAENLPIGISPLVDKVSQFLFDLITSFTEKKMFFIAARCLTFVDLRPSPQICLIMLN
KFFRSYDITNCEIFFDLAARVHFRPSIKEIKPISTEIARILVSKELENVSKNQSSIYAIR
MILYNILDVLSLEESCNLISDIINIRKFAEHVFSDPKFTLLILERLCQFVGTQNELLCQT
LSKFTLFVSTLKISDNYIENLLTLLQGLSIADSPNFKDWLTSNKEIYMIGMEKMKRFFGE
FDDSWQKNFKNSDYLLEFHDTLNEIYNGMNLHVQSVNKFPAILKTITDIYKDDSLRKIEE
DEMNLFWQINSIELSSVQRNCYMMGEHTWPGDCPLIQTPSPIKLPKFGVGTSRPELYTHQ
LPQTICFTTGNNIKLYNEKYTVFATLEKYSKNSAFLPIRCSSSMSNSTKSMYYSFVRKFS
QIPQIYNCKFLKYSDPIQSVTFVDNTKITVLIGASFENTNELKLMKDYISPICYSALSHQ
MTLGMFGKVSLFCGHFAVTVNKSDILLVRKRTYNYQNNCAEIHTWNGTDFNIIFQGNNVP
HIITAFNYDYRFINNKVFNMPLAMMTEQWQISALTTFKYLLGVNFAAGRSFSDYSQYFVF
PWVISNYSDATLDISNQNDVRDLQKPMGMIGEERAKNFMKQRLEKKTEYIIPSHYSMSSA
IHHFLLRCPPHTLIEWDVNNGWEVSTKTFHDLGVSWRNASELQPNDCKELIPEFFCLPEM
FVNRSKLNTRDVMLPKWCQSGPCQFVMANREILNNSEKINLWIDLIFGYLQSGSQAEHIG
NIYDPICYPHKISSSDDRSIVELQISTLGQCPQQIFRKPHPTKIQKTPDDDKEQQKALFR
QKHSSIRPKPNFSQLEESFDGAFCRGKIAVMPQENSVVLHIKKVNSMRCYTTYFNDATAM
SCSEDGNLIVVDDANFVSSVYFIDIVGDFLGVRKVGSKVFEDTVRSRIDSTMQIAISFMK
NYYVLWHPIRGTTLDKVEMDGIIDIIFIEKYLAFCILMPKRLVVRTYSNTDICEMQMQKE
ATCMIKHNDGIFVGYKDGSIEVVAIDRMRLMPKSMKIFEDSTVGIVKLVRNGTYIFAWTT
QDRIISII
Download sequence
Identical sequences A2EA85
89276.m00151 5722.A2EA85 XP_001322648.1.43485 gi|121905498|gb|EAY10425.1| gi|123478976|ref|XP_001322648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]