SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2G611 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2G611
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.81e-70
Family Capz beta-1 subunit 0.0000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2G611
Sequence length 272
Comment (tr|A2G611|A2G611_TRIVA) F-actin capping protein, beta subunit, putative {ECO:0000313|EMBL:EAX87407.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_396060 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MAYDSPVTAGLDLLRHVPPKDIEDRMFDLFQLKPDLTEEMISAVDIPLKVETDKDTQQGF
IKCDYNRDGDSYRSPFTHKYYPPLPDGQQISPKLRKLEELANKAFGSYLNLFFRYGTISV
YCWDLDDISFGLGVFVRKDTDSTEGFLGSINCSDIFTITEKSSGQYDYEMVSSILLEVKV
DVPKSKPVVLSGGCADSKIKTLTAKDNIEMLVNIGTMIEDNAANFMEHVKQIYVSKMSEI
LSYTKGTAFVVAGEAQDLMAQAMKDYVNRSSK
Download sequence
Identical sequences A2G611
gi|121881359|gb|EAX87407.1| gi|123393046|ref|XP_001300337.1| 5722.A2G611 93946.m00031 XP_001300337.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]