SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2GAC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2GAC1
Domain Number 1 Region: 4-261
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.19e-69
Family Capz beta-1 subunit 0.00000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2GAC1
Sequence length 271
Comment (tr|A2GAC1|A2GAC1_TRIVA) F-actin capping protein, beta subunit, putative {ECO:0000313|EMBL:EAX85898.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_261590 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MSYDSPVTAGLDLLRHIPPKDVEERMFDIFELNPDLTDEMISAVDIPLKIQQDNDTQQNF
VKCDYNRDGDSYRSPFTNKYYPPLSDGQTPSPKLRKLEELANKAFGSYLNLFFRYGTLSV
YCWDLDDNSFGLGVFVRKDANESQEDFIGNISCSDVFTITEESSGQYTYEMVSSIMLEIK
VQGANGKPVILSGGCTDSKVKTLPAKGDIEMLVNVGTMIEDNAANFMEYVKQIYVSKMTE
ILSYTKGIAIGGGGNSPQDQLAAAMKARLGK
Download sequence
Identical sequences A2GAC1
88973.m00007 XP_001298828.1.43485 gi|121879512|gb|EAX85898.1| gi|123383511|ref|XP_001298828.1| 5722.A2GAC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]