SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2HW55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2HW55
Domain Number - Region: 80-135
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00798
Family Apolipoprotein 0.045
Further Details:      
 
Domain Number - Region: 33-78
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0576
Family Reductases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2HW55
Sequence length 153
Comment (tr|A2HW55|A2HW55_TRIVA) Uncharacterized protein {ECO:0000313|EMBL:EAX66362.1} KW=Complete proteome; Reference proteome OX=5722 OS=Trichomonas vaginalis. GN=TVAG_521380 OC=Eukaryota; Parabasalia; Trichomonadida; Trichomonadidae; Trichomonas.
Sequence
MLQFKADAEKELKEIHEQQISDFKETWPKTLPAPFRKVSKRVLEIRDQERHLIYMNRYDD
AIEYKNRADRLEKRDIDRQRDNFNDQFRRNLKTLRDAQKKELLALSAKWASKLDELNAHA
KKDIENKKRNIELLKSKLLLDDASRFRLSDYEG
Download sequence
Identical sequences A2HW55
XP_001279292.1.43485 105516.m00003 gi|121828450|gb|EAX66362.1| gi|123167093|ref|XP_001279292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]