SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2QSL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2QSL9
Domain Number - Region: 128-205
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.016
Family Capz beta-1 subunit 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2QSL9
Sequence length 496
Comment (tr|A2QSL9|A2QSL9_ASPNC) Aspergillus niger contig An08c0280, genomic contig {ECO:0000313|EMBL:CAK45791.1} KW=Complete proteome; Reference proteome OX=425011 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513). GN=An08g11200 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MLEDERYHCSLCSCDSLTGTDAKLALNNGPSTSECNVKQHLSPLIQMLNTLCSIPRDHSF
VFDYHTHRMSDRKDEIPYPRRVEAELARERQQASRDRRRLGLVEPILPPENARLVQTTAN
IRAFEEGDPHYYTTSSETSSQRQAVQVQDSQGADIPNDSDGTESELEFHVDEYRDEIYED
MSKPVLFYGKDNQLEDVITYCTLRFLTDDAFDDNDKRKSAYLGTLLRGPALRWLSKEQSV
DPEIYDDYQEFVKKVRTAFAKTEKTKIQEASRRITFLTQKSSNLEHWTNWPEKHRELMSN
CTRLKDLPARIDNMASFQENATNVDDSGTRQRTADSQAASNPSGRPTAAEFLRHMTSTPH
AKRQMDPQTRKQFARFLAPDELQEFYWCNRHGVFPKDLVSCDLERITGTIRDTETGYDRH
RIPGSKIYNEWARIDDASADMDYGYFERTAPWISSDDVARHYEGDCTTPSGMAKLDVQSS
PHIFHILSPQASYTLS
Download sequence
Identical sequences A2QSL9
CADANGAP00007300 5061.CADANGAP00007300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]