SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2QWJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2QWJ9
Domain Number 1 Region: 3-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-82
Family Capz alpha-1 subunit 0.00000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2QWJ9
Sequence length 513
Comment (tr|A2QWJ9|A2QWJ9_ASPNC) Aspergillus niger contig An11c0210, genomic contig {ECO:0000313|EMBL:CAL00393.1} KW=Complete proteome; Reference proteome OX=425011 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513). GN=An11g05460 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MASTIELASSFIEGAPPGELADVVADVKALTSDGPDIIPSLAPAFERYNETQLATVKLPG
ASQEVLISEYNKLEGNRYFDVESQTSFEVDHVTQEASAAQSYVLESQNADLMYAPFPRRS
KSLLKSLSAHATEHYRTCSYGVYPIEDDTAVAIVLVANRYSPNNFWNGRFRAIYTLPVNS
SSATISGQIKVDVHYYEDGNVALNTTKPVNLSVQSVDASAIISRIAAAERDYQEELNRAF
VSTAEGVFKGLRRQLPITRQKVEWEKVGGYRLGQDIAGGRGYRADIAYPLASPLADIYPL
KAIERNQNARPFIPLHANHPRSRKDPPPRPIRLCAGPANTHSGKRIHFAVQHRQDTRDAS
SGSSTSSTASIEHLPCWGDLTLVCTPFPSYSKTYNDTKVSCKLHATSIYPNPYNAAILTE
ANKFWFYALGFSILGAANDILFSSASSTSKTKDEKKPAPSISRFSLLKKMLCVDACDMLI
PGTFLGWIEMGQLGVGIGMVVSTLVSGWDMWNA
Download sequence
Identical sequences A2QWJ9
CADANGAP00008714 5061.CADANGAP00008714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]