SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A2TDH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A2TDH0
Domain Number - Region: 33-63
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 0.0562
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2TDH0
Sequence length 135
Comment (tr|A2TDH0|A2TDH0_9HEPC) Polyprotein {ECO:0000313|EMBL:ABM91014.1} OX=31655 OS=Hepatitis C virus subtype 6a. GN= OC=Flaviviridae; Hepacivirus.
Sequence
TYGNSSGLYHLTNDCPNSSIVLEADAMILHLPGCLPCVRVGNRSTCWHAVSATLAVPNAS
TPATGFRRHVDLLAGAAVVCSSLYIGDLCGSVFLAGQLFTFQPRRHWTVQTCNCSIYTGH
VTGHRMAWDMMMMKT
Download sequence
Identical sequences A2TDH0
A2TDH0_9HEPC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]