SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DD36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3DD36
Domain Number - Region: 26-86
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0706
Family Capz beta-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3DD36
Sequence length 325
Comment (tr|A3DD36|A3DD36_CLOTH) Uncharacterized protein {ECO:0000313|EMBL:ABN51865.1} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_0630 OC=Ruminiclostridium.
Sequence
MLFNVLFSVAIGLVILYILNVVLDLRLLNDLKKLVSYIVDSIANHNTKKYLERIKRSKIV
KTNDNIISKYNRLVENIIFDYNLPLTLEGFNSFISILFAILVLIVVLFLKDITLSALVSI
SLLVGAITYFTMRSRNLKAAKIESIMDAEDLICPLARDGVLVAIKKVLESDEYINADIRP
FFVQFVENCENYGYSFRRAMEILNRQLGPKFDNFAKKAVIFEYNERKGMADIFLDIVEEN
AALREINARKNRIFKKMNMNFIMKTALIVIFVAYSMTVPELRIFMLESTAGRFILTMTIV
AICLSFARCQALQADIGSFGGDNKW
Download sequence
Identical sequences A3DD36
gi|125973148|ref|YP_001037058.1| 203119.Cthe_0630 WP_003516564.1.16390 WP_003516564.1.19387 WP_003516564.1.20586 WP_003516564.1.31213 WP_003516564.1.55520 WP_003516564.1.60145 WP_003516564.1.6636 WP_003516564.1.6965 gi|385778945|ref|YP_005688110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]