SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3GGE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3GGE4
Domain Number 1 Region: 4-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.29e-66
Family Capz beta-1 subunit 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3GGE4
Sequence length 293
Comment (tr|A3GGE4|A3GGE4_PICST) Uncharacterized protein {ECO:0000313|EMBL:EAZ63506.2} KW=Complete proteome; Reference proteome OX=322104 OS=NRRL Y-11545) (Yeast) (Pichia stipitis). GN=PICST_38898 OC=Scheffersomyces.
Sequence
MSYDDKFDSSLDLLRRLDPRTISANLNSVCSLIQNGSDDNEEVVQDLLSSVDTPLQVRKC
VQSGKSYLCCDYNRDGDSYRSPWSNKYYPSPNGDDDIPPPYPSDLLRQLELKANDSFDVY
RDLYYEGSGISSVYLWDSAEDDEPDSLTDGFAGVVLFKKETDDGSGKWDSIHVFEVVPVS
ANSFSYKLTSTVILDLQNKQTSSLSLSGNLTRQLETSATAELDSGLNLETNHLIQLGQLV
EKSEYNIRNLLQEVYFDKLKDIMLKDLRSVGEISDKKLEDLRQSEMIKGLQSL
Download sequence
Identical sequences A3GGE4
XP_001387529.2.38308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]