SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3LXR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3LXR0
Domain Number 1 Region: 5-259
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.02e-65
Family Capz alpha-1 subunit 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3LXR0
Sequence length 266
Comment (tr|A3LXR0|A3LXR0_PICST) Uncharacterized protein {ECO:0000313|EMBL:ABN67842.1} KW=Complete proteome; Reference proteome OX=322104 OS=NRRL Y-11545) (Yeast) (Pichia stipitis). GN=PICST_48821 OC=Scheffersomyces.
Sequence
MSSAIKLDSLVNSLVESAAPTELPYVSKDLSILLSGSNSSTVVDSIEEFVNEKAAVFSSA
YIASKHNKDSSSSKYIDFISKKKFNIDINTQRAIDFEPFSPLVEYPEYYNDLVEKLGQYG
EDHYPSTFVFTVVPKSSDEVEIIIIGQRLNHENFFTGQWKSIYTISNTSISGEVSLDIHY
YEDGNVRLNFNKAVKENLSSANASAIINAINDLENKITMQIVENFNDLNQKYFKNLRRLL
PVTRSKINWGSAIGNYRLGSDVVHKK
Download sequence
Identical sequences A3LXR0
4924.PICST_48821 XP_001385871.1.38308 jgi|Picst3|48821|e_gwh1.6.1.912.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]