SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3QHX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3QHX3
Domain Number - Region: 6-33
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0141
Family Capz alpha-1 subunit 0.027
Further Details:      
 
Domain Number - Region: 31-73
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 0.0732
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3QHX3
Sequence length 89
Comment (tr|A3QHX3|A3QHX3_SHELP) NapD family protein {ECO:0000313|EMBL:ABO25071.1} KW=Complete proteome; Reference proteome OX=323850 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4). GN=Shew_3205 OC=Shewanellaceae; Shewanella.
Sequence
MTQEYHVTSLVVHAAPGQVAKVTEDINALAGADIHAVTDEGKFIITLEGATQGAILDNVE
AINALSGVLSSSLVYHQVEPIEEKSEETP
Download sequence
Identical sequences A3QHX3
WP_011867001.1.33760 2005185333 2005185859 gi|127514133|ref|YP_001095330.1| 2005320595 323850.Shew_3205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]