SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4AM15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A4AM15
Domain Number - Region: 341-498
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0019
Family Amylase, catalytic domain 0.033
Further Details:      
 
Domain Number - Region: 581-706
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00968
Family Capz alpha-1 subunit 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4AM15
Sequence length 722
Comment (tr|A4AM15|A4AM15_MARSH) Uncharacterized protein {ECO:0000313|EMBL:EAR02037.1} KW=Complete proteome; Reference proteome OX=313603 OS=Maribacter sp. (strain HTCC2170 / KCCM 42371). GN=FB2170_02100 OC=Flavobacteriaceae; Maribacter.
Sequence
MILKSRIGKFVSLMVVGISSTLCMAQKSEDTKDWLIDNSGFTSLVIQKGNDISLDNGLVN
RTIRIAPNAATVEYRNLTTGESMLRSIKPEAEVSINGETYAVGGLVGLKEHGYLLEEWLD
DLTADADAFQYVKHEVKQIQSKIKWNDKKRFHTTENATPKGKELIIQFNHSLKELDGVLV
NVHYEIYDGIPLIAKWISVENKSNKSIGITGFKNEILAFPEAENFVEPSKRWRRPNMHVE
SDYSFGGFTSGESETSIFWEFDPEYTSQVNWLMKTECLLESKLLVGPNEVVKPKDSFESF
HTYELLQDNTDRERTSLAVRKMYRLLAPWSTENPIFMHLTTTNPEKVKTAIDQCEATGYE
MVILSFGSGLNMEDNSEGNIKKFKELADYAHNKGIELGGYSLFSSRKISDSVDVIDKDTG
KPGGAKFGNAPCLASEWGHTYLKRIKYFLDKTGFDLLEHDGPYPGDYCASTTHKHHKGYE
DSQWVQWNMTKDFYHWLKEKDIYLNAPDFYYLQGSNKCGIGYREVNWSLPRAQQIMLGRQ
NIYDGTWEKTPSMAWTFVPLTEYHGGGAEATLEPLNDHLDSYEAHMVQNYGSGVQACYRG
PRLFDSQATKELVIDQIDHYKKYRNILNSDIIHLRRPDGRTWDGFMHVNPSLEEKALVML
FNPTSKTIEEEISLPLYFTGLDEEARIVEKGENSLTSKLNRNYESEIKVTIPPNGYTWLV
VQ
Download sequence
Identical sequences A4AM15
WP_013305109.1.69417 gi|305665053|ref|YP_003861340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]