SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4TZP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A4TZP5
Domain Number - Region: 128-155
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.016
Family Capz alpha-1 subunit 0.034
Further Details:      
 
Domain Number - Region: 89-115
Classification Level Classification E-value
Superfamily N-(deoxy)ribosyltransferase-like 0.0229
Family N-deoxyribosyltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4TZP5
Sequence length 182
Comment (tr|A4TZP5|A4TZP5_9PROT) Uncharacterized protein {ECO:0000313|EMBL:CAM76102.1} OX=55518 OS=Magnetospirillum gryphiswaldense. GN=MGR_3254 OC=Rhodospirillaceae; Magnetospirillum.
Sequence
MPWDSLELSKLAIQAATPVVAIGIAYRINRAIEQFKHTQWRNQKLIERRIAAYDTISPEL
NDIICYYAYIGRWKEFSPLDILSKKRSVDKSIYLSAPFFSEDILEPYDRIMDLCFSMFSG
NGQDARLRTKAQNRKPFFNGAWDSTWDTRFTDEKLAPATYFDAYHKLISIFSNEIGLESV
NK
Download sequence
Identical sequences A4TZP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]