SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A5B1I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5B1I1
Domain Number - Region: 93-205
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0178
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5B1I1
Sequence length 256
Comment (tr|A5B1I1|A5B1I1_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CAN67393.1} OX=29760 OS=Vitis vinifera (Grape). GN=VITISV_041597 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MENYSDLGNSAQIFELKSKIDEIKQEDQEHRTKLDPHALKRVFMGYSPTQKGYKCYDLIS
RKIFVSMNVTFFENQPYFTKNTPKGENVVKEDCFWEMSLLLPTFDNNVIQKVILCKYPRV
RTGHRDPRRLSNSFKAFTSNMSFVEIPKSIQDALVVPKRKETVMEEMRVLEMNGALDXVE
RYKAKLVAKGFXKTYXIDYQETFMSIARMNTIQISLSLPINLNWPLQQLDVNAFLNGELE
EVYMNLPPGFLAIIWN
Download sequence
Identical sequences A5B1I1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]