SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A5BMP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5BMP3
Domain Number 1 Region: 2-245
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.5e-74
Family Capz beta-1 subunit 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A5BMP3
Sequence length 256
Comment (tr|A5BMP3|A5BMP3_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CAN65826.1} OX=29760 OS=Vitis vinifera (Grape). GN=VITISV_027402 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MEAALGLMRRIHPKHSETALSALLGLLPHLSSDLLSQVDQPLQVLCDVDSGKEFILCEYN
RDADSYRSPWSNKYHPPLEDGPYPSSELRKLEIEANEVFSIYRDQYYEGGISSVYMWEDE
NEGFVXCFLIKKDGSKTGHGRRGYLQEGSWDAIHVIEVGPDEEGITHYCLTSTVMLSLTT
NDQSSGTFSLSGSIRRQMNMDLSIADGHLCNMGKMIEEMESKLRNSLDQVYFGKTKEMVC
TLRPPAEVLPMRLPXS
Download sequence
Identical sequences A5BMP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]