SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A5F9M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A5F9M7
Domain Number - Region: 18-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0195
Family MarR-like transcriptional regulators 0.058
Further Details:      
 
Domain Number - Region: 89-196
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0254
Family EspA-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5F9M7
Sequence length 291
Comment (tr|A5F9M7|A5F9M7_CLOK5) Phage related replication protein {ECO:0000313|EMBL:ABQ23634.1} KW=Complete proteome; Reference proteome OX=431943 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680). GN=CKL_4035 OC=Clostridium.
Sequence
MATIRVQKNENYSTINNTGLNDCNLSFKAKGILAYLLSKPDNWKCQVSDLIKKSKDGRDS
VYAGLRELRENGYMIKRPVKNEKNIITEWEEVLYETPQLEAKEVFKEQKIKNEIAALKRA
KTIKSKKINPLPENPYMEESTSGISVSGKPVNIISTNLPSTDLVVVVNSLIKEFEENICD
LKKTTKPKFIKYCQEYSKEYIMTILEVCAESGIKSFAGFRTVIETHIKNKNDTPEKIRAA
VEKYRQDKKNKQKVPANRKQNTSENFKQRDYNFGDLEKMLLNHMNYEEDEE
Download sequence
Identical sequences A5F9M7 B9E6G1
gi|148245143|ref|YP_001219836.1| 431943.CKL_4035 583346.CKR_P19 WP_011930381.1.77168 WP_011930381.1.89246 gi|148245143|ref|YP_001219836.1|NC_009466 gi|219684047|ref|YP_002470429.1|NC_011836 gi|219684047|ref|YP_002470429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]