SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A5K974 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5K974
Domain Number 1 Region: 10-304
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-68
Family Capz alpha-1 subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5K974
Sequence length 331
Comment (tr|A5K974|A5K974_PLAVS) F-actin capping protein, alpha subunit, putative {ECO:0000313|EMBL:EDL43946.1} KW=Complete proteome; Reference proteome OX=126793 OS=Plasmodium vivax (strain Salvador I). GN=PVX_079825 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MKDDKMESLLNEKKNFIRHVLMNAPPGKVADLVSDLKTLFGTSVVIQNSIEEAVAAHSEK
NYAIIPLSGDEYVITCEESKVGNSYLQPKLKSLLDVNHLKKKVNTTEDFEELSYPELLEN
YRKSCSAKLEEYVQAHYSNWNELQTINYPTVNINSKNGLSVKCCSSVYATEREGRFNLLL
IVCCDRHYLKNFHASSWRSSWNVTFLTTDEEVLLNGTIDVVLTYFEDANINFKATKNFEK
TVHVNNDVDTFSANILSAIRECENCALYELNEFLLHIDKELIKNTRKIIPFNGDKFDWKE
TYQDIPAQIKSAHACKCVCVDTRAYWKKLYL
Download sequence
Identical sequences A0A0J9SSX9 A0A0J9TW54 A0A0J9VXZ0 A5K974
XP_001613673.1.43797 gb|PVX_079825 gi|156095276|ref|XP_001613673.1| 5855.PVX_079825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]