SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6BGF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6BGF4
Domain Number 1 Region: 150-280
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.4e-16
Family HD domain 0.064
Further Details:      
 
Weak hits

Sequence:  A6BGF4
Domain Number - Region: 34-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.024
Family Single strand DNA-binding domain, SSB 0.052
Further Details:      
 
Domain Number - Region: 108-144
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0915
Family Capz alpha-1 subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6BGF4
Sequence length 313
Comment (tr|A6BGF4|A6BGF4_9FIRM) HDIG domain protein {ECO:0000313|EMBL:EDM63365.1} KW=Complete proteome OX=411462 OS=Dorea longicatena DSM 13814. GN=DORLON_01376 OC=Dorea.
Sequence
MRYINTLHEGETIRNVYLCKGKRSAETRNGRPYDNLILQDKTGTLDGKVWDPNSGGIADY
DEMDFIEVYGEIISYNNNLQLNIKQIRKAQEGEYIAADYMPTTEKSTDGMYEELLGYIKK
VENQYLRQVLEYYFVKDETFIRNFKGHSAAKTVHHGFAGGLLEHTLSVVKFCDYMVGAYP
ILNKDLLFTAAICHDIGKTKELSSFPENDYTDEGQLLGHIVIGVEMIGDAARNIPDFPEK
LANELKHCIVAHHGELEYGSPKKPALAEAMALNLADNADAKMQTLTELFKDKKGNDWLGY
NRLFESNIRKTVI
Download sequence
Identical sequences A6BGF4
WP_006427015.1.65480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]