SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6C3P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A6C3P2
Domain Number - Region: 233-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0251
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6C3P2
Sequence length 379
Comment (tr|A6C3P2|A6C3P2_9PLAN) Uncharacterized protein {ECO:0000313|EMBL:EDL60837.1} KW=Complete proteome; Reference proteome OX=344747 OS=Gimesia maris DSM 8797. GN=PM8797T_26755 OC=Planctomycetaceae; Gimesia.
Sequence
MTHTKFPVSPDVIPKTPPEKVDYVGKLRVAFRRPIEATWFPRKPLVACDDDHALITAMKM
SFYDHFPLRLSPDVIWITLVRGFALHVNENAESLRHHFVSHSGKKELIVSRTDFSPGEEN
PWPEVFSDFNQQIADHTGGLSELVQADFSTTGPVERAVSSLMAMETFKSYFEYILYAGCG
IPSITLTGTIEDWEKLRHCVRRFADYGLNEWISAIDPILGEFVNAKKGQVNTEFWKSLFR
YNSGSGPAVMTGWANVLFPYFKDNNSEKLYPNPYLSDWNERLSIDDQQNWKERWDNPQGV
GLSAIPSCFTSVPLTVFWGERETKMRLVGGLLGVSQDDETLEVEPECGWAIVYEEPVDPL
STDYQRLENLQRNRESDKN
Download sequence
Identical sequences A6C3P2
WP_002645273.1.64681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]