SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6GBY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6GBY3
Domain Number 1 Region: 137-175
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000115
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 2 Region: 221-259
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000679
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Weak hits

Sequence:  A6GBY3
Domain Number - Region: 57-95
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000157
Family Somatomedin B domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6GBY3
Sequence length 334
Comment (tr|A6GBY3|A6GBY3_9DELT) Kazal domain protein {ECO:0000313|EMBL:EDM76656.1} KW=Complete proteome; Reference proteome OX=391625 OS=Plesiocystis pacifica SIR-1. GN=PPSIR1_18342 OC=Nannocystineae; Nannocystaceae; Plesiocystis.
Sequence
MFKTIQFTRLLSFLPFALLTVTACGDVDSATTELDADRLDADRLDAAEQNLEFRAGGSCS
AEDCGLYNPFASCQCDDACVLYGDCCDDQAMVCGPDAGPGEFCGGIAGFECNEGLTCIQD
PGTCLVADAGGTCQVVPEFCTEQYQPVCGCDGVTYDNDCFANQAGVTIDHEGACGGKGGA
GEGEFCGGIAGFVCAEGLTCVQEPGTCDVSDAGGTCESVGPFCTEQYEPVCGCDGKTYGN
ACKAKVAGVTIDTVGECAPVDACESDKDCKEGFCGWNDDSSRVCKPWAQVGESCEGFVLP
QFRAFCAPGLECEFPEPTNDVPGTCVDPSAAELG
Download sequence
Identical sequences A6GBY3
WP_006974224.1.5293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]