SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6M2H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6M2H0
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 4.85e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0068
Further Details:      
 
Weak hits

Sequence:  A6M2H0
Domain Number - Region: 44-123
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0732
Family Capz alpha-1 subunit 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6M2H0
Sequence length 202
Comment (tr|A6M2H0|A6M2H0_CLOB8) Transcriptional regulator, TetR family {ECO:0000313|EMBL:ABR36800.1} KW=Complete proteome; Reference proteome OX=290402 OS=acetobutylicum). GN=Cbei_4692 OC=Clostridium.
Sequence
MNTREKIISESLNLFSRKGFDAISVRDIAKAVGIKASSLYNHFKNKQDIFDTIIQKYSDL
VNKFLNSIKIRDNSDENLPNKTNLLSDEYFFKKSSYIFNFYLEDENMIKFRKLLTIEQCN
NSKLSDLYNKIFIDDILDFQADVFSKLISSNVFIKKDPYTLALQFYSPVFLLFYKHENLT
DKERRFLENHISEFKDTYIVKG
Download sequence
Identical sequences A0A1S8R7A2 A6M2H0
290402.Cbei_4692 gi|150019502|ref|YP_001311756.1| WP_012060846.1.44456 WP_012060846.1.51202 WP_012060846.1.88565 WP_012060846.1.91641 WP_012060846.1.96201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]