SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7C520 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7C520
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily AF1862-like 0.0000196
Family Cas Cmr5-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7C520
Sequence length 47
Comment (tr|A7C520|A7C520_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EDN66114.1} KW=Complete proteome; Reference proteome OX=422289 OS=Beggiatoa sp. PS. GN=BGP_3164 OC=Thiotrichaceae; Beggiatoa.
Sequence
MEGITQSDMHTYLAAQAEAMVFMNWVKLFANAFMKESTAQTSEGIHS
Download sequence
Identical sequences A7C520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]