SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7ID20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7ID20
Domain Number 1 Region: 37-270
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.07e-69
Family Ferredoxin domains from multidomain proteins 0.000000366
Further Details:      
 
Domain Number 2 Region: 258-301
Classification Level Classification E-value
Superfamily Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.0000000144
Family Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7ID20
Sequence length 323
Comment (tr|A7ID20|A7ID20_XANP2) Formate dehydrogenase, beta subunit {ECO:0000313|EMBL:ABS65913.1} KW=Complete proteome; Reference proteome OX=78245 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2). GN=Xaut_0661 OC=Xanthobacteraceae; Xanthobacter.
Sequence
MFPPIPNPPVTPTPAKFGDSDLVRRSASNLRVPVEFKEPVAKLIDVSKCIGCKACQAACL
EWNQLHEEIGTFNGSYTNPPDLTPNSLTLMRFTEWVNPETDNLEWLIRKDGCMHCADPGC
LKACPAPGAIVQYSNGIVDFDHDKCIGCGYCVKGCPFNIPRISKVDNKAYKCTLCSDRVA
VGQGPACQKACPTQAIVFGTKTQMKEWAEGRIKDLKSRGYKNAGLYDPPGVGGTHVMYVL
QHADQPSIYAGLPDNPRISRIVEAWKGVTKYVGLGVMGFAAIAGALHYLVAGANKVTAED
EANAEKLAQGQLPGGEPAHGGRS
Download sequence
Identical sequences A7ID20
WP_012112682.1.63109 gi|154244612|ref|YP_001415570.1| 78245.Xaut_0661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]