SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7LR91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7LR91
Domain Number - Region: 314-417
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00863
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7LR91
Sequence length 429
Comment (tr|A7LR91|A7LR91_BACO1) Uncharacterized protein {ECO:0000313|EMBL:EDO14027.1} KW=Complete proteome OX=411476 OS=NCTC 11153). GN=BACOVA_00316 OC=Bacteroides.
Sequence
MKKNELLNLLYVERQRLSEQNSHIGWSIWILIGCIITLSWMLLEHYETSSMKSDQFCWSQ
IVTLMGDFITVAFALLLIKNYYNDKKNSFHFDRFDKSKLPIFIILDTVIAILLYIYHKVF
SNDSIGIILTNTIIFYCGVKCSELYQSLKCKQQIPLLYKQLVYAFASIIILIAAGCKIGT
HYNYYIINTKYALLASGIIIVLYILLWHIWNPIKKSIIAIDKLINEMIINEGTDTKEIYN
NLIAIKIGYKYSQLYENKLQKIGSLLKKQNGYITLIERNIKKLEIDQNIETEELNKNSKL
FNLIKKNNETSFHLIDKILSNIQKDLNHILVNEENEKEINKLLSIINNNLSISKKKRELI
ETLLNKYETLLNKQVDKYQKMIDEQSKCQYYCRFANNKFLCYTHRCLYFFTKKWNSIKVF
VEHYKWRRG
Download sequence
Identical sequences A7LR91
WP_004296102.1.17530 WP_004296102.1.37910 WP_004296102.1.79560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]